ZNF155 Peptide - C-terminal region
ZNF155 Peptide - C-terminal region
Product Specifications
Product Name Alternative
PHZ-96
UniProt
Q12901
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with ZNF155 Rabbit Polyclonal Antibody (orb324738) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
XP_005259272
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: CDTCDKSFHQRSALNRHCMVHTGEKPYRCEQCGKGFIGRLDFYKHQVVHT
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
LY400062 100 µg
alpha 1 Glycine Receptor (GLRA1) (NM_000171) Human Over-expression Lysate
Sign In for Pricing
View Details 
AP51760PU-N 400 µL
Galanin (GAL) (Center) Rabbit Polyclonal Antibody
Sign In for Pricing
View Details 