Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF8 Peptide - C-terminal region

ZNF8 Peptide - C-terminal region

Product Specifications

Product Name Alternative

ZNF8

UniProt

P17098

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ZNF8 Rabbit Polyclonal Antibody (orb577141) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_066575

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EQSSSRNSHLVQHQHPNSRKSSAGGAKAGQPESRALALFDIQKIMQEKNP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ALAS2 (NM_001037968) Human Over-expression Lysate
LY421997 100 µg

ALAS2 (NM_001037968) Human Over-expression Lysate

Sign In for Pricing
View Details
IL15 Antibody (Biotin)
KB-3680-01 50 μL

IL15 Antibody (Biotin)

Sign In for Pricing
View Details
IL15 Antibody (Biotin)
KB-3680-02 100 µL

IL15 Antibody (Biotin)

Sign In for Pricing
View Details
IL15 Antibody (Biotin)
KB-3680-03 1 mL

IL15 Antibody (Biotin)

Sign In for Pricing
View Details
Neo Spiramycin I
TRC-N390040-5MG 5 mg

Neo Spiramycin I

Sign In for Pricing
View Details
Human MASS1 (ADGRV1) activation kit by CRISPRa
GA113343 1 Kit

Human MASS1 (ADGRV1) activation kit by CRISPRa

Sign In for Pricing
View Details