Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF8 Peptide - C-terminal region

ZNF8 Peptide - C-terminal region

Product Specifications

Product Name Alternative

ZNF8

UniProt

P17098

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ZNF8 Rabbit Polyclonal Antibody (orb577141) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_066575

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EQSSSRNSHLVQHQHPNSRKSSAGGAKAGQPESRALALFDIQKIMQEKNP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

10-Hydroxy-2-decenoic acid
TRC-H943213-500MG 500 mg

10-Hydroxy-2-decenoic acid

Sign In for Pricing
View Details
GST3 Rabbit Polyclonal Antibody
ER1802-63 100 µL

GST3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
C1QB (NM_000491) Human Over-expression Lysate
LY424687 100 µg

C1QB (NM_000491) Human Over-expression Lysate

Sign In for Pricing
View Details
CD31 Recombinant Mouse monoclonal Antibody
HA610115 100 µg

CD31 Recombinant Mouse monoclonal Antibody

Sign In for Pricing
View Details
Glypican 3 (GPC3) (Center) Rabbit Polyclonal Antibody
AP13408PU-N 400 µL

Glypican 3 (GPC3) (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
PPAP2C (PLPP2) Rabbit Polyclonal Antibody
TA368674 100 µL

PPAP2C (PLPP2) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details