LRPPRC Peptide - N-terminal region
LRPPRC Peptide - N-terminal region
Product Specifications
Product Name Alternative
LSFC, GP130, LRP130, CLONE-23970
UniProt
P42704
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with LRPPRC Rabbit Polyclonal Antibody (orb324932) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_573566
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: NEYKFSPTDFLAKMEEANIQPNRVTYQRLIASYCNVGDIEGASKILGFMK
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
AP06178PU-N 100 µg
IGF1 Receptor (IGF1R) Rabbit Polyclonal Antibody
Sign In for Pricing
View Details 
BNCB2259-100 1x 100 µL
Protein Tyrosine Phosphatase, non-receptor type 6 (CPTC-PTPN6-2), Biotin conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
