Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GAMT Peptide - N-terminal region

GAMT Peptide - N-terminal region

Product Specifications

Product Name Alternative

GAMT

UniProt

Q14353

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GAMT Rabbit Polyclonal Antibody (orb578166) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_620279

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: IPLKGLWEDVAPTLPDGHFDGILYDTYPLSEETWHTHQFNFIKNHAFRLL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Beta-2 Microglobulin (B2M) (B2M/961), Biotin conjugate, 0.1mg/mL
BNCB0961-100 1x 100 µL

Beta-2 Microglobulin (B2M) (B2M/961), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ELYS (AHCTF1) Human Gene Knockout Kit (CRISPR)
KN415742 1 Kit

ELYS (AHCTF1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Fibronectin (Fn-3), CF640R conjugate, 0.1mg/mL
BNC402848-500 1x 500 µL

Fibronectin (Fn-3), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PAK1 (NM_001128620) Human Recombinant Protein
TP325947L 1 mg

PAK1 (NM_001128620) Human Recombinant Protein

Sign In for Pricing
View Details
DAB2 (NM_001343) Human Over-expression Lysate
LC400534 20 µg

DAB2 (NM_001343) Human Over-expression Lysate

Sign In for Pricing
View Details
PECR Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1E12]
TA501964BM 100 µL

PECR Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1E12]

Sign In for Pricing
View Details