GAMT Peptide - N-terminal region
GAMT Peptide - N-terminal region
Product Specifications
Product Name Alternative
GAMT
UniProt
Q14353
Field of Research
Signal Transduction
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with GAMT Rabbit Polyclonal Antibody (orb578166) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_620279
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: IPLKGLWEDVAPTLPDGHFDGILYDTYPLSEETWHTHQFNFIKNHAFRLL
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC943124-100 1x 100 µL
CD21 (Mature B-Cell & Follicular Dendritic Cell Marker) (CR2/3124R), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC881711-500 1x 500 µL
Desmin (Muscle Cell Marker) (DES/1711), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
KN400250 1 Kit
EBNA1 binding protein 2 (EBNA1BP2) Human Gene Knockout Kit (CRISPR)
Sign In for Pricing
View Details 