EPS8L1 Peptide - C-terminal region
EPS8L1 Peptide - C-terminal region
Product Specifications
Product Name Alternative
DRC3, EPS8R1, PP10566
UniProt
Q8TE68
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with EPS8L1 Rabbit Polyclonal Antibody (orb578576) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: GRSAWPRLTRLSYFLQQSAPQVAVNGHRDLEPESEPQLESETAGKWVLCN
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC471805-100 1x 100 µL
GP2 (Glycoprotein 2) / ZAP75 (GP2/1805), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
