EPS8L1 Peptide - C-terminal region
EPS8L1 Peptide - C-terminal region
Product Specifications
Product Name Alternative
DRC3, EPS8R1, PP10566
UniProt
Q8TE68
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with EPS8L1 Rabbit Polyclonal Antibody (orb578576) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: GRSAWPRLTRLSYFLQQSAPQVAVNGHRDLEPESEPQLESETAGKWVLCN
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNCB1670-500 1x 500 µL
NSE gamma (Neuron Specific Enolase, gamma) (Neuroendocrine Marker) (NSE-P2), Biotin conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BCFLR-301 1 Unit
Floor Type Low Speed Refrigerated Centrifuge BCFLR-301
Sign In for Pricing
View Details 
LC401792 20 µg
MC4 Receptor (MC4R) (NM_005912) Human Over-expression Lysate
Sign In for Pricing
View Details 
