Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FOXR2 Peptide - middle region

FOXR2 Peptide - middle region

Product Specifications

Product Name Alternative

FOXR2, FOXN6

UniProt

Q6PJQ5

Field of Research

Cancer Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with FOXR2 Rabbit Polyclonal Antibody (orb578609) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_940853

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SPSDFELTEEEAEEPDDNSLQSPEMKCYQSQKLWQINNQEKSWQRPPLNC

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RGD1563224 Protein Vector (Rat) (pPB-N-His)
PV300687 500 ng

RGD1563224 Protein Vector (Rat) (pPB-N-His)

Sign In for Pricing
View Details
CXCL2 (CINC-2a, C-X-C Motif Chemokine 2, Growth-regulated Protein beta, Macrophage inflammatory protein 2-alpha, GRO2, GROb, MGSA-b, MIP-2a, MIP2, MIP2A, SCYB2)
368088 100 µg

CXCL2 (CINC-2a, C-X-C Motif Chemokine 2, Growth-regulated Protein beta, Macrophage inflammatory protein 2-alpha, GRO2, GROb, MGSA-b, MIP-2a, MIP2, MIP2A, SCYB2)

Sign In for Pricing
View Details
UBA52 Antibody
DF8021-01 100 µL

UBA52 Antibody

Sign In for Pricing
View Details
UBA52 Antibody
DF8021-02 200 µL

UBA52 Antibody

Sign In for Pricing
View Details
OR52N2 Antibody
MBS8513565-01 0.05 mg

OR52N2 Antibody

Sign In for Pricing
View Details
OR52N2 Antibody
MBS8513565-02 0.1 mg

OR52N2 Antibody

Sign In for Pricing
View Details