FOXR2 Peptide - middle region
FOXR2 Peptide - middle region
Product Specifications
Product Name Alternative
FOXR2, FOXN6
UniProt
Q6PJQ5
Field of Research
Cancer Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with FOXR2 Rabbit Polyclonal Antibody (orb578609) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_940853
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: SPSDFELTEEEAEEPDDNSLQSPEMKCYQSQKLWQINNQEKSWQRPPLNC
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS850637-02 0.1 mL (AF635)
Beta 2-Microglobulin (beta2-MG) Antibody-HRP
Sign In for Pricing
View Details MBS850637-03 0.1 mL (AF610)
Beta 2-Microglobulin (beta2-MG) Antibody-HRP
Sign In for Pricing
View Details MBS850637-04 0.1 mL (AF405S)
Beta 2-Microglobulin (beta2-MG) Antibody-HRP
Sign In for Pricing
View Details MBS850637-05 0.1 mL (AF405L)
Beta 2-Microglobulin (beta2-MG) Antibody-HRP
Sign In for Pricing
View Details MBS850637-06 0.1 mL (AF546)
Beta 2-Microglobulin (beta2-MG) Antibody-HRP
Sign In for Pricing
View Details