Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PARD3 Peptide - N-terminal region

PARD3 Peptide - N-terminal region

Product Specifications

Product Name Alternative

PARD3, PAR3, PAR3A

UniProt

Q8TEW0

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PARD3 Rabbit Polyclonal Antibody (orb578643) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LEHGDGGILDLDDILCDVADDKDRLVAVFDEQDPHHGGDGTSASSTGTQS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti-Shigella flexneri BARA Polyclonal Antibody
MBS7161016 Inquire

Rabbit anti-Shigella flexneri BARA Polyclonal Antibody

Sign In for Pricing
View Details
PDK1 Antibody, HRP conjugated
A54235-50UG 50 µg

PDK1 Antibody, HRP conjugated

Sign In for Pricing
View Details
Ufsp2 Mouse qPCR Template Standard (NM_138668)
MK200404 1 Kit

Ufsp2 Mouse qPCR Template Standard (NM_138668)

Sign In for Pricing
View Details
Valyllysine
MBS5784513 Inquire

Valyllysine

Sign In for Pricing
View Details
C9orf64 Antibody - C-terminal region : FITC (ARP60393_P050-FITC)
ARP60393_P050-FITC 100 µL

C9orf64 Antibody - C-terminal region : FITC (ARP60393_P050-FITC)

Sign In for Pricing
View Details
TIM4 Rabbit Polyclonal Antibody (Biotin)
orb1596354 100 µL

TIM4 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details