Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PARD3 Peptide - N-terminal region

PARD3 Peptide - N-terminal region

Product Specifications

Product Name Alternative

PARD3, PAR3, PAR3A

UniProt

Q8TEW0

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PARD3 Rabbit Polyclonal Antibody (orb578643) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LEHGDGGILDLDDILCDVADDKDRLVAVFDEQDPHHGGDGTSASSTGTQS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PSMD9 siRNA Oligos set (Human)
38011171 3x 5 nmol

PSMD9 siRNA Oligos set (Human)

Sign In for Pricing
View Details
Rabbit Polyclonal H1N1 Neuraminidase Antibody [DyLight 550]
NBP2-41110R 0.1 mL

Rabbit Polyclonal H1N1 Neuraminidase Antibody [DyLight 550]

Sign In for Pricing
View Details
Rps6kc1 siRNA Oligos set (Rat)
42601176 3x 5 nmol

Rps6kc1 siRNA Oligos set (Rat)

Sign In for Pricing
View Details
RTL10 Rabbit Polyclonal Antibody (Fluoro594)
orb3091988 100 µg

RTL10 Rabbit Polyclonal Antibody (Fluoro594)

Sign In for Pricing
View Details
Rat Cldn19 Pre-designed siRNA Set A
SI202848A 1 Each

Rat Cldn19 Pre-designed siRNA Set A

Sign In for Pricing
View Details
TUBB3 (Neuronal Marker) Monoclonal Antibody, PE-Cy5 Conjugated
bsm-33177M-PE-Cy5 100 µL

TUBB3 (Neuronal Marker) Monoclonal Antibody, PE-Cy5 Conjugated

Sign In for Pricing
View Details