Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNRF4 Peptide - N-terminal region

ZNRF4 Peptide - N-terminal region

Product Specifications

Product Name Alternative

ZNRF4, RNF204

UniProt

Q8WWF5

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ZNRF4 Rabbit Polyclonal Antibody (orb578845) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_859061

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: TQLPSRPGHRPPGRPRRCPKASCLPPPVGPSSTQTAKRVTMGWPRPGRAL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue Total RNA, Breast
CR560441 5 µg

Tissue Total RNA, Breast

Sign In for Pricing
View Details
anti-CD23 (1E9)
LF-MA20342 100 ug

anti-CD23 (1E9)

Sign In for Pricing
View Details
Mgat1 sgRNA CRISPR Lentivector (Rat) (Target 1)
K7036402 1.0 µg DNA

Mgat1 sgRNA CRISPR Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details
BCAS2 (DAM1) discontinued
507211 100 µg

BCAS2 (DAM1) discontinued

Sign In for Pricing
View Details
[Asn370]-Tyrosinase (368-376)
MBS8245910-01 1 mg

[Asn370]-Tyrosinase (368-376)

Sign In for Pricing
View Details
[Asn370]-Tyrosinase (368-376)
MBS8245910-02 5 mg

[Asn370]-Tyrosinase (368-376)

Sign In for Pricing
View Details