Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TRIM49B Peptide - N-terminal region

TRIM49B Peptide - N-terminal region

Product Specifications

Product Name Alternative

RNF18B

UniProt

A6NDI0

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TRIM49B Rabbit Polyclonal Antibody (orb325085) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_001193555

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: CPIESAAEEHQEKLLQKMQSLWEKACENHRNLNVETTRTRCWKDYVNLRL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SMC3 Polyclonal Antibody
E55A01560 100 µg

SMC3 Polyclonal Antibody

Sign In for Pricing
View Details
C12orf50 Recombinant Protein (Human)
RP003640 100 µg

C12orf50 Recombinant Protein (Human)

Sign In for Pricing
View Details
Clu sgRNA CRISPR Lentivector set (Mouse)
K3937201 3x 1.0 µg

Clu sgRNA CRISPR Lentivector set (Mouse)

Sign In for Pricing
View Details
Calb2 (NM_007586) Mouse Tagged ORF Clone Lentiviral Particle
MR203611L3V 200 µL

Calb2 (NM_007586) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
D16H22S680E Protein Vector (Mouse) (pPM-C-His)
PV170053 500 ng

D16H22S680E Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details
ZNF419, ID (ZNF419, ZNF419A, Zinc finger protein 419)
MBS6008294-01 0.2 mL

ZNF419, ID (ZNF419, ZNF419A, Zinc finger protein 419)

Sign In for Pricing
View Details