Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TRIM49B Peptide - N-terminal region

TRIM49B Peptide - N-terminal region

Product Specifications

Product Name Alternative

RNF18B

UniProt

A6NDI0

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TRIM49B Rabbit Polyclonal Antibody (orb325085) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_001193555

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: CPIESAAEEHQEKLLQKMQSLWEKACENHRNLNVETTRTRCWKDYVNLRL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MED18 Polyclonal Antibody
MBS2542548-01 0.02 mL

MED18 Polyclonal Antibody

Sign In for Pricing
View Details
MED18 Polyclonal Antibody
MBS2542548-02 0.06 mL

MED18 Polyclonal Antibody

Sign In for Pricing
View Details
MED18 Polyclonal Antibody
MBS2542548-03 0.12 mL

MED18 Polyclonal Antibody

Sign In for Pricing
View Details
MED18 Polyclonal Antibody
MBS2542548-04 0.2 mL

MED18 Polyclonal Antibody

Sign In for Pricing
View Details
Diazobenzenesulfonic acid
MBS5773751 Inquire

Diazobenzenesulfonic acid

Sign In for Pricing
View Details
ASB15 Protein Vector (Mouse) (pPB-N-His)
PV156611 500 ng

ASB15 Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details