Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GPM6B Peptide - N-terminal region

GPM6B Peptide - N-terminal region

Product Specifications

Product Name Alternative

GPM6B, M6B

UniProt

Q13491

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_005269

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SGVALFCGCGHVALAGTVAILEQHFSTNASDHALLSEVIQLMQYVIYGIA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human ACOT1 shRNA (UAS) - Lentiviral human ACOT1 shRNA (UAS) (25)
GTR15162953 1 Vial

Lentiviral human ACOT1 shRNA (UAS) - Lentiviral human ACOT1 shRNA (UAS) (25)

Sign In for Pricing
View Details
Rabbit anti-Saccharomyces cerevisiae (strain 204508/S288c)(Baker's yeast) YHR049C-A Polyclonal Antibody
MBS7180870 Inquire

Rabbit anti-Saccharomyces cerevisiae (strain 204508/S288c)(Baker's yeast) YHR049C-A Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant human respiratory syncytial virus (RSV) Nucleoprotein Protein (N-His tag)
EGPS062D-50 50 µg

Recombinant human respiratory syncytial virus (RSV) Nucleoprotein Protein (N-His tag)

Sign In for Pricing
View Details
Rabbit Monoclonal EphB3 Antibody (115) [PerCP]
NBP2-90645PCP 0.1 mL

Rabbit Monoclonal EphB3 Antibody (115) [PerCP]

Sign In for Pricing
View Details
CNOT10 (H-9) : m-IgG Fc BP-HRP Bundle
sc-527916 1 Kit

CNOT10 (H-9) : m-IgG Fc BP-HRP Bundle

Sign In for Pricing
View Details
Lmo1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
K7158305 3x 1.0 µg

Lmo1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details