Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GPM6B Peptide - N-terminal region

GPM6B Peptide - N-terminal region

Product Specifications

Product Name Alternative

GPM6B, M6B

UniProt

Q13491

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_005269

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SGVALFCGCGHVALAGTVAILEQHFSTNASDHALLSEVIQLMQYVIYGIA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hydroxyprogesterone Impurity 21
RM-P157021-01 10 mg

Hydroxyprogesterone Impurity 21

Sign In for Pricing
View Details
Hydroxyprogesterone Impurity 21
RM-P157021-02 25 mg

Hydroxyprogesterone Impurity 21

Sign In for Pricing
View Details
Hydroxyprogesterone Impurity 21
RM-P157021-03 50 mg

Hydroxyprogesterone Impurity 21

Sign In for Pricing
View Details
Hydroxyprogesterone Impurity 21
RM-P157021-04 100 mg

Hydroxyprogesterone Impurity 21

Sign In for Pricing
View Details
Mmu-miR-6978-3p miRNA Agomir
CMN1426-01 5 nmol

Mmu-miR-6978-3p miRNA Agomir

Sign In for Pricing
View Details
Mmu-miR-6978-3p miRNA Agomir
CMN1426-02 10 nmol

Mmu-miR-6978-3p miRNA Agomir

Sign In for Pricing
View Details