Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SSR1 Peptide - C-terminal region

SSR1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

TRAPA

UniProt

P43307

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SSR1 Rabbit Polyclonal Antibody (orb325217) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_003135

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VKFLVGFTNKGTEDFIVESLDASFRYPQDYQFYIQNFTALPLNTVVPPQR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EHD3 Rabbit Polyclonal Antibody (Carrier-free)
orb3105400 100 µg

EHD3 Rabbit Polyclonal Antibody (Carrier-free)

Sign In for Pricing
View Details
AKAP8 Antibody
CSB-PA145524-01 50 μL

AKAP8 Antibody

Sign In for Pricing
View Details
AKAP8 Antibody
CSB-PA145524-02 100 µL

AKAP8 Antibody

Sign In for Pricing
View Details
PAM (m) -PR
sc-155926-PR 10 µM - 20 µL

PAM (m) -PR

Sign In for Pricing
View Details
ABCG5 Antibody
CSB-PA935474-01 50 μL

ABCG5 Antibody

Sign In for Pricing
View Details
ABCG5 Antibody
CSB-PA935474-02 100 µL

ABCG5 Antibody

Sign In for Pricing
View Details