Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZP2 Peptide - C-terminal region

ZP2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

ZP2, ZPA

UniProt

Q05996

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ZP2 Rabbit Polyclonal Antibody (orb579474) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_003451

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: CSYSRNDMLLNINVESLTPPVASVKLGPFTLILQSYPDNSYQQPYGENEY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZKSCAN1 Polyclonal Antibody
E-AB-52371-01 20 µL

ZKSCAN1 Polyclonal Antibody

Sign In for Pricing
View Details
ZKSCAN1 Polyclonal Antibody
E-AB-52371-02 60 µL

ZKSCAN1 Polyclonal Antibody

Sign In for Pricing
View Details
ZKSCAN1 Polyclonal Antibody
E-AB-52371-03 120 µL

ZKSCAN1 Polyclonal Antibody

Sign In for Pricing
View Details
ZKSCAN1 Polyclonal Antibody
E-AB-52371-04 200 µL

ZKSCAN1 Polyclonal Antibody

Sign In for Pricing
View Details
Microplate Shaker BSTH-111
BSTH-111 1 Unit

Microplate Shaker BSTH-111

Sign In for Pricing
View Details
(R)-Norfenfluramine Hydrochloride
TRC-N680985-50MG 50 mg

(R)-Norfenfluramine Hydrochloride

Sign In for Pricing
View Details