Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZP2 Peptide - C-terminal region

ZP2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

ZP2, ZPA

UniProt

Q05996

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ZP2 Rabbit Polyclonal Antibody (orb579474) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_003451

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: CSYSRNDMLLNINVESLTPPVASVKLGPFTLILQSYPDNSYQQPYGENEY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant GFAP Antibody
RC-012-01 50 μL

Recombinant GFAP Antibody

Sign In for Pricing
View Details
Recombinant GFAP Antibody
RC-012-02 100 µL

Recombinant GFAP Antibody

Sign In for Pricing
View Details
Recombinant GFAP Antibody
RC-012-03 1 mL

Recombinant GFAP Antibody

Sign In for Pricing
View Details
p114RhoGEF (ARHGEF18) Mouse Monoclonal Antibody [Clone ID: OTI4B5]
CF810293 100 µg

p114RhoGEF (ARHGEF18) Mouse Monoclonal Antibody [Clone ID: OTI4B5]

Sign In for Pricing
View Details
Frozen Tissue Sections, Ovary
CS629105 5x 5 µm

Frozen Tissue Sections, Ovary

Sign In for Pricing
View Details
PDHA1 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2B10]
TA502704BM 100 µL

PDHA1 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2B10]

Sign In for Pricing
View Details