Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MBL2 Peptide - N-terminal region

MBL2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

MBL2, COLEC1, MBL

UniProt

P11226

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MBL2 Rabbit Polyclonal Antibody (orb579533) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

XP_006717924

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SETVTCEDAQKTCPAVIACSSPGINGFPGKDGRDGTKGEKGEPGQGLRGL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZPI Rabbit Polyclonal Antibody
E28PN1123 100 µL

ZPI Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Sabinene
C03937 100 mg

Sabinene

Sign In for Pricing
View Details
Conjugated HDAC6 Rabbit mAb
C59127 100 µL

Conjugated HDAC6 Rabbit mAb

Sign In for Pricing
View Details
L-Canavanine Sulfate Salt
40300003-1 100 mg

L-Canavanine Sulfate Salt

Sign In for Pricing
View Details
Porcine 8-iso prostaglandin (8-iso-PG) ELISA Kit
YLA0128PO-01 48 Tests

Porcine 8-iso prostaglandin (8-iso-PG) ELISA Kit

Sign In for Pricing
View Details
Porcine 8-iso prostaglandin (8-iso-PG) ELISA Kit
YLA0128PO-02 96 Tests

Porcine 8-iso prostaglandin (8-iso-PG) ELISA Kit

Sign In for Pricing
View Details