Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MBL2 Peptide - N-terminal region

MBL2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

MBL2, COLEC1, MBL

UniProt

P11226

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MBL2 Rabbit Polyclonal Antibody (orb579533) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

XP_006717924

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SETVTCEDAQKTCPAVIACSSPGINGFPGKDGRDGTKGEKGEPGQGLRGL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TNMD siRNA (Human)
orb1856338-01 15 nmol

TNMD siRNA (Human)

Sign In for Pricing
View Details
TNMD siRNA (Human)
orb1856338-02 30 nmol

TNMD siRNA (Human)

Sign In for Pricing
View Details
Epithelial Stromal Interaction 1 (EPSTI1) (NM_033255) Human Recombinant Protein
TP317229L 1 mg

Epithelial Stromal Interaction 1 (EPSTI1) (NM_033255) Human Recombinant Protein

Sign In for Pricing
View Details
HDAC4 Rabbit pAb, PE-Cy5 conjugated
orb2892023 100 µL

HDAC4 Rabbit pAb, PE-Cy5 conjugated

Sign In for Pricing
View Details
Fluorescent Substrate for Glu-Specific Proteases
orb1942380-01 5 mg

Fluorescent Substrate for Glu-Specific Proteases

Sign In for Pricing
View Details
Fluorescent Substrate for Glu-Specific Proteases
orb1942380-02 50 mg

Fluorescent Substrate for Glu-Specific Proteases

Sign In for Pricing
View Details