Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TDO2 Peptide - C-terminal region

TDO2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

TO, TDO, TPH2, TRPO, HYPTRP

UniProt

P48775

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TDO2 Rabbit Polyclonal Antibody (orb325226) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_005642

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: MDIDSLMTKWRYNHVCMVHRMLGSKAGTGGSSGYHYLRSTVSDRYKVFVD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TSC2, phosphorylated (Ser1420) (Tuberin, Tuberous Sclerosis 2 Protein, TSC4) (PE) discontinued
T9100-25G7-PE 200 µL

TSC2, phosphorylated (Ser1420) (Tuberin, Tuberous Sclerosis 2 Protein, TSC4) (PE) discontinued

Sign In for Pricing
View Details
HECTD3 Knockout Raji Polyclonal Cells
ARG23680 1 Million

HECTD3 Knockout Raji Polyclonal Cells

Sign In for Pricing
View Details
Human NAPG Pre-designed siRNA Set B
SI010253B 1 Each

Human NAPG Pre-designed siRNA Set B

Sign In for Pricing
View Details
Dynorphin A (1-6)
orb1940916-01 100 mg

Dynorphin A (1-6)

Sign In for Pricing
View Details
Dynorphin A (1-6)
orb1940916-02 200 mg

Dynorphin A (1-6)

Sign In for Pricing
View Details
Dynorphin A (1-6)
orb1940916-03 500 mg

Dynorphin A (1-6)

Sign In for Pricing
View Details