Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TDO2 Peptide - C-terminal region

TDO2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

TO, TDO, TPH2, TRPO, HYPTRP

UniProt

P48775

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TDO2 Rabbit Polyclonal Antibody (orb325226) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_005642

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: MDIDSLMTKWRYNHVCMVHRMLGSKAGTGGSSGYHYLRSTVSDRYKVFVD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PAQR3 Protein Vector (Rat) (pPM-C-HA)
PV292380 500 ng

PAQR3 Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
Hepatitis C virus NS4 Recombinant Protein
orb1230317 0.01 mg

Hepatitis C virus NS4 Recombinant Protein

Sign In for Pricing
View Details
PE/Cyanine7 Anti-Mouse CD200/OX2 Antibody[OX-90]
FCE3607-01 50 Tests

PE/Cyanine7 Anti-Mouse CD200/OX2 Antibody[OX-90]

Sign In for Pricing
View Details
PE/Cyanine7 Anti-Mouse CD200/OX2 Antibody[OX-90]
FCE3607-02 100 Tests

PE/Cyanine7 Anti-Mouse CD200/OX2 Antibody[OX-90]

Sign In for Pricing
View Details
PE/Cyanine7 Anti-Mouse CD200/OX2 Antibody[OX-90]
FCE3607-03 2x 100 Tests

PE/Cyanine7 Anti-Mouse CD200/OX2 Antibody[OX-90]

Sign In for Pricing
View Details
IGF-1 (Murine) OmniKine ELISA Kit
MBS9501903-01 1 Kit

IGF-1 (Murine) OmniKine ELISA Kit

Sign In for Pricing
View Details