Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KRTAP26-1 Peptide - C-terminal region

KRTAP26-1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

KAP26.1

UniProt

Q6PEX3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with KRTAP26-1 Rabbit Polyclonal Antibody (orb325244) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_981950

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SGCQPSSCLAYRPQSLHVVSSSLRPLGPLFSGCQPLTHVFSTCRPSCSGL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EEFSEC (NM_021937) Human Tagged ORF Clone
RC220621 10 µg

EEFSEC (NM_021937) Human Tagged ORF Clone

Sign In for Pricing
View Details
Hrb2 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
K6614205 3x 1.0 µg

Hrb2 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details
Unhealthy ribosome biogenesis protein 2 homolog (URB2) Human ELISA Kit
I1304 96 Tests

Unhealthy ribosome biogenesis protein 2 homolog (URB2) Human ELISA Kit

Sign In for Pricing
View Details
Purified anti-human CD62L
MBS9472726-01 0.1 mg

Purified anti-human CD62L

Sign In for Pricing
View Details
Purified anti-human CD62L
MBS9472726-02 1 mg

Purified anti-human CD62L

Sign In for Pricing
View Details
Purified anti-human CD62L
MBS9472726-03 5x 1 mg

Purified anti-human CD62L

Sign In for Pricing
View Details