Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KRTAP26-1 Peptide - C-terminal region

KRTAP26-1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

KAP26.1

UniProt

Q6PEX3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with KRTAP26-1 Rabbit Polyclonal Antibody (orb325244) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_981950

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SGCQPSSCLAYRPQSLHVVSSSLRPLGPLFSGCQPLTHVFSTCRPSCSGL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Olfr1232 AAV Vector (Mouse) (CMV)
32692104 1 µg

Olfr1232 AAV Vector (Mouse) (CMV)

Sign In for Pricing
View Details
Mmu-miR-7215-3p miRNA Inhibitor
CIM1685-01 10 nmol

Mmu-miR-7215-3p miRNA Inhibitor

Sign In for Pricing
View Details
Mmu-miR-7215-3p miRNA Inhibitor
CIM1685-02 20 nmol

Mmu-miR-7215-3p miRNA Inhibitor

Sign In for Pricing
View Details
Kcnk5 AAV siRNA Pooled Vector
25402164 1.0 µg

Kcnk5 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
MDL-104168
orb1739058-01 25 mg

MDL-104168

Sign In for Pricing
View Details
MDL-104168
orb1739058-02 50 mg

MDL-104168

Sign In for Pricing
View Details