Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DTNB Peptide - C-terminal region

DTNB Peptide - C-terminal region

Product Specifications

Product Name Alternative

DTNB

UniProt

O60941

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with DTNB Rabbit Polyclonal Antibody (orb579745) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: STPTHCPQDSLSGVGGDVQEAFAQGTRRNLRNDLLVAADSITNTMSSLVK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OR2D2 Antibody
OAAF05094-100UG 100 µg

OR2D2 Antibody

Sign In for Pricing
View Details
ATG12 AAV Vector (Human) (CMV)
12624102 1 µg

ATG12 AAV Vector (Human) (CMV)

Sign In for Pricing
View Details
ZNF237 Blocking Peptide
33R-1996 0.1 mg

ZNF237 Blocking Peptide

Sign In for Pricing
View Details
N4BP2L1 sgRNA CRISPR Lentivector set (Human)
K1384801 3x 1.0 µg

N4BP2L1 sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details
CARD 6 Polyclonal Antibody
RA22697-01 50 µL

CARD 6 Polyclonal Antibody

Sign In for Pricing
View Details
CARD 6 Polyclonal Antibody
RA22697-02 100 µL

CARD 6 Polyclonal Antibody

Sign In for Pricing
View Details