Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DTNB Peptide - C-terminal region

DTNB Peptide - C-terminal region

Product Specifications

Product Name Alternative

DTNB

UniProt

O60941

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with DTNB Rabbit Polyclonal Antibody (orb579745) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: STPTHCPQDSLSGVGGDVQEAFAQGTRRNLRNDLLVAADSITNTMSSLVK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Clostridium Botulinum dnaJ Protein (aa 1-373) (strain Eklund 17B / Type B)
VAng-Lsx8170-1mgEcoli 1 mg (E. coli)

Recombinant Clostridium Botulinum dnaJ Protein (aa 1-373) (strain Eklund 17B / Type B)

Sign In for Pricing
View Details
WASF2 (NM_001201404) Human Tagged ORF Clone
RC233631 10 µg

WASF2 (NM_001201404) Human Tagged ORF Clone

Sign In for Pricing
View Details
1700020O03Rik Protein Lysate (Mouse) with C-HA Tag
10188034 100 µg

1700020O03Rik Protein Lysate (Mouse) with C-HA Tag

Sign In for Pricing
View Details
HSP70 Rabbit Polyclonal Antibody (BF680)
orb1583168 100 µL

HSP70 Rabbit Polyclonal Antibody (BF680)

Sign In for Pricing
View Details
Mouse Monoclonal MUC-1 Antibody (rMUC1/960) [Allophycocyanin]
NBP2-54346APC 100 µL

Mouse Monoclonal MUC-1 Antibody (rMUC1/960) [Allophycocyanin]

Sign In for Pricing
View Details
Sheep TDP43 ELISA Kit
OM619207 96 Strip Well

Sheep TDP43 ELISA Kit

Sign In for Pricing
View Details