DNAJC16 Peptide - C-terminal region
DNAJC16 Peptide - C-terminal region
Product Specifications
Product Name Alternative
KIAA0962
UniProt
Q9Y2G8
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with DNAJC16 Rabbit Polyclonal Antibody (orb325316) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: KHREWLEYLLEFAQDAAPIPNQYDKHFMERDYTGYVLALNGHKKYFCLFK
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
LC426744 20 µg
HP1 alpha (CBX5) (NM_001127321) Human Over-expression Lysate
Sign In for Pricing
View Details 
