Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DNAJC16 Peptide - C-terminal region

DNAJC16 Peptide - C-terminal region

Product Specifications

Product Name Alternative

KIAA0962

UniProt

Q9Y2G8

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with DNAJC16 Rabbit Polyclonal Antibody (orb325316) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KHREWLEYLLEFAQDAAPIPNQYDKHFMERDYTGYVLALNGHKKYFCLFK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Uncoated Human OC/BGP (Osteocalcin) ELISA Kit
E-UNEL-H0121-01 5x 96 Tests

Uncoated Human OC/BGP (Osteocalcin) ELISA Kit

Sign In for Pricing
View Details
Uncoated Human OC/BGP (Osteocalcin) ELISA Kit
E-UNEL-H0121-02 15x 96 Tests

Uncoated Human OC/BGP (Osteocalcin) ELISA Kit

Sign In for Pricing
View Details
TTI1 Human Gene Knockout Kit (CRISPR)
KN401622 1 Kit

TTI1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CD22 / BL-CAM (B-Cell Marker) (RFB4), 0.2mg/mL
BNUB1594-500 1x 500 µL

CD22 / BL-CAM (B-Cell Marker) (RFB4), 0.2mg/mL

Sign In for Pricing
View Details
Myoglobin Recombinant Rabbit Monoclonal Antibody [SC06-38]
ET1610-56 100 µL

Myoglobin Recombinant Rabbit Monoclonal Antibody [SC06-38]

Sign In for Pricing
View Details
C3orf38 Polyclonal Antibody
E-AB-18571-01 20 µL

C3orf38 Polyclonal Antibody

Sign In for Pricing
View Details