Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ALDOA Peptide - C-terminal region

ALDOA Peptide - C-terminal region

Product Specifications

Product Name Alternative

ALDOA, ALDA

UniProt

P04075

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ALDOA Rabbit Polyclonal Antibody (orb580289) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_908932

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ALQASALKAWGGKKENLKAAQEEYVKRALANSLACQGKYTPSGQAGAAAS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human GI24 (C10orf54) activation kit by CRISPRa
GA111984 1 Kit

Human GI24 (C10orf54) activation kit by CRISPRa

Sign In for Pricing
View Details
Anti-ARC
Y058421 100 µL

Anti-ARC

Sign In for Pricing
View Details
CT47A10 (NM_001080137) Human Over-expression Lysate
LC421593 20 µg

CT47A10 (NM_001080137) Human Over-expression Lysate

Sign In for Pricing
View Details
CD54 / ICAM-1 (15.2), CF740 conjugate, 0.1mg/mL
BNC742853-100 1x 100 µL

CD54 / ICAM-1 (15.2), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
NPTX2 Antibody
KC-2349-01 50 μL

NPTX2 Antibody

Sign In for Pricing
View Details
NPTX2 Antibody
KC-2349-02 100 µL

NPTX2 Antibody

Sign In for Pricing
View Details