ALDOA Peptide - C-terminal region
ALDOA Peptide - C-terminal region
Product Specifications
Product Name Alternative
ALDOA, ALDA
UniProt
P04075
Field of Research
Metabolism Research
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with ALDOA Rabbit Polyclonal Antibody (orb580289) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_908932
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: ALQASALKAWGGKKENLKAAQEEYVKRALANSLACQGKYTPSGQAGAAAS
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
LY425285 100 µg
C6orf140 (GLYATL3) (NM_001010904) Human Over-expression Lysate
Sign In for Pricing
View Details 
T-2101-5 5 mg
Texas Red Conjugated Triticum vulgare Lectin (Wheat Germ) -WGA-
Sign In for Pricing
View Details 
BNC740970-100 1x 100 µL
GLG1 (Golgi Complex) (GLG1/970), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details