ATP6V1E1 Peptide - N-terminal region
ATP6V1E1 Peptide - N-terminal region
Product Specifications
Product Name Alternative
P31, Vma4, ATP6E, ARCL2C, ATP6E2, ATP6V1E
UniProt
P36543
Field of Research
Neuroscience
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with ATP6V1E1 Rabbit Polyclonal Antibody (orb325388) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_001687
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: IEQEANEKAEEIDAKAEEEFNIEKGRLVQTQRLKIMEYYEKKEKQIEQQK
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC400218-500 1x 500 µL
CD100 (Semaphorin-4D) (A8), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC682853-500 1x 500 µL
CD54 / ICAM-1 (15.2), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC401429-500 1x 500 µL
E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC470630-100 1x 100 µL
Mucin 1 / EMA / Episialin / CD227 (VU-2G7), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC940257-100 1x 100 µL
Cytokeratin, HMW (AE-3), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details