Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NUDT17 Peptide - C-terminal region

NUDT17 Peptide - C-terminal region

Product Specifications

UniProt

P0C025

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NUDT17 Rabbit Polyclonal Antibody (orb325397) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_001012776

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RMIPTMAEDKERVSTGTKFALKLWLQHLGRTPPPCKSAAYLDPGPAKEEW

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Gemin5 Antibody
orb1528608-01 10 µL

Rabbit Gemin5 Antibody

Sign In for Pricing
View Details
Rabbit Gemin5 Antibody
orb1528608-02 100 µL

Rabbit Gemin5 Antibody

Sign In for Pricing
View Details
Anti-PASK Antibody FITC Conjugated
A04726-2-FITC 100 µg/Vial

Anti-PASK Antibody FITC Conjugated

Sign In for Pricing
View Details
LSAMP Protein Vector (Rat) (pPB-C-His)
PV280238 500 ng

LSAMP Protein Vector (Rat) (pPB-C-His)

Sign In for Pricing
View Details
mmu-miR-709 miRNA Inhibitor
MBS8295698-01 10 nmol

mmu-miR-709 miRNA Inhibitor

Sign In for Pricing
View Details
mmu-miR-709 miRNA Inhibitor
MBS8295698-02 20 nmol

mmu-miR-709 miRNA Inhibitor

Sign In for Pricing
View Details