Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NUDT17 Peptide - C-terminal region

NUDT17 Peptide - C-terminal region

Product Specifications

UniProt

P0C025

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NUDT17 Rabbit Polyclonal Antibody (orb325397) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_001012776

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RMIPTMAEDKERVSTGTKFALKLWLQHLGRTPPPCKSAAYLDPGPAKEEW

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Dacisteine
abx188671 5 g

Dacisteine

Sign In for Pricing
View Details
FATP2 (SLC27A2) (NM_003645) Human Tagged Lenti ORF Clone
RC221033L1 10 µg

FATP2 (SLC27A2) (NM_003645) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Tetranectin Recombinant Antibody, AbBy Fluor™ 405 Conjugated
bsm-61920R-BF405-01 20 µL

Tetranectin Recombinant Antibody, AbBy Fluor™ 405 Conjugated

Sign In for Pricing
View Details
Tetranectin Recombinant Antibody, AbBy Fluor™ 405 Conjugated
bsm-61920R-BF405-02 100 µL

Tetranectin Recombinant Antibody, AbBy Fluor™ 405 Conjugated

Sign In for Pricing
View Details
Anti-DNAJC10 Polyclonal Antibody
TMAB-05235-01 50 μL

Anti-DNAJC10 Polyclonal Antibody

Sign In for Pricing
View Details
Anti-DNAJC10 Polyclonal Antibody
TMAB-05235-02 100 µL

Anti-DNAJC10 Polyclonal Antibody

Sign In for Pricing
View Details