RABGGTA Peptide - N-terminal region
RABGGTA Peptide - N-terminal region
Product Specifications
Product Name Alternative
PTAR3
UniProt
Q92696
Field of Research
Signal Transduction
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with RABGGTA Rabbit Polyclonal Antibody (orb325447) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_878256
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: LDESVLELTSQILGANPDFATLWNCRREVLQQLETQKSPEELAALVKAEL
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC400009-100 1x 100 µL
MART-1 / Melan-A (M2-7C10), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC740178-100 1x 100 µL
CD50 (ICAM-3) (186-2G9), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC680029-500 1x 500 µL
Fibronectin (TV-1), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC740633-100 1x 100 µL
Von Willebrand Factor (3E2D10), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC880304-500 1x 500 µL
CD106 / VCAM1 (B-K9), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC940745-500 1x 500 µL
CD45 / LCA (2B11 + PD7/26), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details