NUDT1 Peptide - middle region
NUDT1 Peptide - middle region
Product Specifications
Product Name Alternative
MTH1
UniProt
P36639
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with NUDT1 Rabbit Polyclonal Antibody (orb325449) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: WNGFGGKVQEGETIEDGARRELQEESGLTVDALHKVGQIVFEFVGEPELM
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
CDA-C52H4-1mg 1 mg
Cynomolgus CD8 alpha / CD8A Protein, His Tag (MALS verified)
Sign In for Pricing
View Details 
MBS1385678-01 0.5 mg (E-Coli)
Recombinant Schizosaccharomyces pombe Probable N-acetylglucosaminyl-phosphatidylinositol de-N-acetylase (SPAPB2B4.01c), partial
Sign In for Pricing
View Details MBS1385678-02 0.05 mg (Baculovirus)
Recombinant Schizosaccharomyces pombe Probable N-acetylglucosaminyl-phosphatidylinositol de-N-acetylase (SPAPB2B4.01c), partial
Sign In for Pricing
View Details