Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NUDT1 Peptide - middle region

NUDT1 Peptide - middle region

Product Specifications

Product Name Alternative

MTH1

UniProt

P36639

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NUDT1 Rabbit Polyclonal Antibody (orb325449) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: WNGFGGKVQEGETIEDGARRELQEESGLTVDALHKVGQIVFEFVGEPELM

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BMP8b Polyclonal Antibody, Cy7 Conjugated
bs-12873R-Cy7 100 µL

BMP8b Polyclonal Antibody, Cy7 Conjugated

Sign In for Pricing
View Details
Myelin Oligodendrocyte Glycoprotein
548794 200 µL

Myelin Oligodendrocyte Glycoprotein

Sign In for Pricing
View Details
PTPRU sgRNA CRISPR Lentivector (Human) (Target 1)
K1759202 1.0 µg DNA

PTPRU sgRNA CRISPR Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
MAG Rabbit pAb
E45R27180N-100 100 µL

MAG Rabbit pAb

Sign In for Pricing
View Details
Human FAM205A Knockout A549 cell line
GTR15406087 1 Vial

Human FAM205A Knockout A549 cell line

Sign In for Pricing
View Details
TEM5 HDR Plasmid (m)
sc-429676-HDR 20 µg

TEM5 HDR Plasmid (m)

Sign In for Pricing
View Details