Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TRPV5 Peptide - N-terminal region

TRPV5 Peptide - N-terminal region

Product Specifications

Product Name Alternative

TRPV5, ECAC1

UniProt

Q9NQA5

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TRPV5 Rabbit Polyclonal Antibody (orb330583) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_062815

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GFLPKAEGPGSQLQKLLPSFLVREQDWDQHLDKLHMLQQKRILESPLLRA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Breast
CS621957 5x 5 µm

Frozen Tissue Sections, Breast

Sign In for Pricing
View Details
P73 Antibody
8C10080-AAT 50 µg

P73 Antibody

Sign In for Pricing
View Details
CD300LD Rabbit Polyclonal Antibody
TA383931 100 µL

CD300LD Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Bismuth Subnitrate
TRC-B497285-10G 10 g

Bismuth Subnitrate

Sign In for Pricing
View Details
Quinoline Yellow (Technical Grade)
TRC-Q990080-500MG 500 mg

Quinoline Yellow (Technical Grade)

Sign In for Pricing
View Details
Human OTUD5 activation kit by CRISPRa
GA110808 1 Kit

Human OTUD5 activation kit by CRISPRa

Sign In for Pricing
View Details