Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TRPV5 Peptide - N-terminal region

TRPV5 Peptide - N-terminal region

Product Specifications

Product Name Alternative

TRPV5, ECAC1

UniProt

Q9NQA5

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TRPV5 Rabbit Polyclonal Antibody (orb330583) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_062815

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GFLPKAEGPGSQLQKLLPSFLVREQDWDQHLDKLHMLQQKRILESPLLRA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human CIDE C (CIDEC) activation kit by CRISPRa
GA111918 1 Kit

Human CIDE C (CIDEC) activation kit by CRISPRa

Sign In for Pricing
View Details
SIGLEC6 (NM_001177547) Human Over-expression Lysate
LC433004 20 µg

SIGLEC6 (NM_001177547) Human Over-expression Lysate

Sign In for Pricing
View Details
Apolipoprotein L 2 (APOL2) (NM_145637) Human Recombinant Protein
TP316858M 100 µg

Apolipoprotein L 2 (APOL2) (NM_145637) Human Recombinant Protein

Sign In for Pricing
View Details
Recombinant Mouse ST6GAL1 Protein (His Tag)
PKSM040506 100 µg

Recombinant Mouse ST6GAL1 Protein (His Tag)

Sign In for Pricing
View Details
Human TIMM10 activation kit by CRISPRa
GA108886 1 Kit

Human TIMM10 activation kit by CRISPRa

Sign In for Pricing
View Details
MSH6 (DNA Mismatch Repair Protein) (MSH6/2927), CF740 conjugate, 0.1mg/mL
BNC742927-100 1x 100 µL

MSH6 (DNA Mismatch Repair Protein) (MSH6/2927), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details