Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CLEC7A Peptide - N-terminal region

CLEC7A Peptide - N-terminal region

Product Specifications

Product Name Alternative

BGR, CD369, CANDF4, SCARE2, DECTIN1, CLECSF12

UniProt

Q9BXN2

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CLEC7A Rabbit Polyclonal Antibody (orb325506) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GYTQLHFDSQSNTRIAVVSEKGSCAASPPWRLIAVILGILCLVILVIAVV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Als2 AAV siRNA Pooled Vector
11805164 1.0 µg

Als2 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
KRT85 Polyclonal Antibody
MBS9236001-01 0.1 mL

KRT85 Polyclonal Antibody

Sign In for Pricing
View Details
KRT85 Polyclonal Antibody
MBS9236001-02 5x 0.1 mL

KRT85 Polyclonal Antibody

Sign In for Pricing
View Details
Human phosphorylated epidermal growth factor receptor (p-EGFR) ELISA Kit
YP-W11016-01 48 Tests

Human phosphorylated epidermal growth factor receptor (p-EGFR) ELISA Kit

Sign In for Pricing
View Details
Human phosphorylated epidermal growth factor receptor (p-EGFR) ELISA Kit
YP-W11016-02 96 Tests

Human phosphorylated epidermal growth factor receptor (p-EGFR) ELISA Kit

Sign In for Pricing
View Details
AIM39 Antibody
orb844288 2 mg

AIM39 Antibody

Sign In for Pricing
View Details