Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CLEC7A Peptide - N-terminal region

CLEC7A Peptide - N-terminal region

Product Specifications

Product Name Alternative

BGR, CD369, CANDF4, SCARE2, DECTIN1, CLECSF12

UniProt

Q9BXN2

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CLEC7A Rabbit Polyclonal Antibody (orb325506) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GYTQLHFDSQSNTRIAVVSEKGSCAASPPWRLIAVILGILCLVILVIAVV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ALDH1A2 Rabbit Polyclonal Antibody
TA342735 100 µL

ALDH1A2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
BMPR1A Human qPCR Primer Pair (NM_004329)
HP207659 200 Reactions

BMPR1A Human qPCR Primer Pair (NM_004329)

Sign In for Pricing
View Details
Phospho-eIF4E-S209 Rabbit mAb
AP1024-01 20 µL

Phospho-eIF4E-S209 Rabbit mAb

Sign In for Pricing
View Details
Phospho-eIF4E-S209 Rabbit mAb
AP1024-02 100 μL

Phospho-eIF4E-S209 Rabbit mAb

Sign In for Pricing
View Details
Phospho-eIF4E-S209 Rabbit mAb
AP1024-03 500 μL

Phospho-eIF4E-S209 Rabbit mAb

Sign In for Pricing
View Details
Phospho-eIF4E-S209 Rabbit mAb
AP1024-04 1000 μL

Phospho-eIF4E-S209 Rabbit mAb

Sign In for Pricing
View Details