YAP1 Peptide - C-terminal region
YAP1 Peptide - C-terminal region
Product Specifications
Product Name Alternative
YAP1, YAP65
UniProt
P46937
Field of Research
Cancer Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with YAP1 Rabbit Polyclonal Antibody (orb581119) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: LNSGTYHSRDESTDSGLSMSSYSVPRTPDDFLNSVDEMDTGDTINQSTLP
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
E-BC-K033-S-01 50 Assays (48 samples)
Vitamin E (VE) Colorimetric Assay Kit
Sign In for Pricing
View Details E-BC-K033-S-02 100 Assays (96 samples)
Vitamin E (VE) Colorimetric Assay Kit
Sign In for Pricing
View Details 
D1132-10TP 1 Each
Bulk Beads, Zirconium, 1.0mm, Triple-Pure Molecular Biology Grade, 250g
Sign In for Pricing
View Details 
