YAP1 Peptide - C-terminal region
YAP1 Peptide - C-terminal region
Product Specifications
Product Name Alternative
YAP1, YAP65
UniProt
P46937
Field of Research
Cancer Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with YAP1 Rabbit Polyclonal Antibody (orb581119) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: LNSGTYHSRDESTDSGLSMSSYSVPRTPDDFLNSVDEMDTGDTINQSTLP
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
TP306187M 100 µg
TXNDC (TMX1) (NM_030755) Human Recombinant Protein
Sign In for Pricing
View Details ![Geranyl Nitrile [Mixture of (E)- and (Z)- Isomers, (1:1)]](https://cdn.genprice.uk/products/572/4471970789077/imageurl/trc-g367505-5g.webp)
TRC-G367505-5G 5 g
Geranyl Nitrile [Mixture of (E)- and (Z)- Isomers, (1:1)]
Sign In for Pricing
View Details 
![MAX Mouse Monoclonal Antibody [Clone ID: OTI1D6]](https://cdn.genprice.uk/products/937/68dd18bc061270361e909173/imageurl/cf815024.webp)