PTOV1 Peptide - N-terminal region
PTOV1 Peptide - N-terminal region
Product Specifications
Product Name Alternative
PTOV1, ACID2, PP642, UNQ6127/PRO20092
UniProt
Q86YD1
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with PTOV1 Rabbit Polyclonal Antibody (orb581142) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
XP_005259057
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: LPCQAYVNQGENLETDQWPQKLIMQLIPQQLLTTLGPLFRNSQLAQFHFT
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS911312-01 24 Well (LIMIT 1)
Mouse Tumor necrosis factor receptor superfamily member 13C, TNFRSF13C ELISA Kit
Sign In for Pricing
View Details MBS911312-02 48 Well
Mouse Tumor necrosis factor receptor superfamily member 13C, TNFRSF13C ELISA Kit
Sign In for Pricing
View Details MBS911312-03 96 Well
Mouse Tumor necrosis factor receptor superfamily member 13C, TNFRSF13C ELISA Kit
Sign In for Pricing
View Details MBS911312-04 5x 96 Well
Mouse Tumor necrosis factor receptor superfamily member 13C, TNFRSF13C ELISA Kit
Sign In for Pricing
View Details MBS911312-05 10x 96 Well
Mouse Tumor necrosis factor receptor superfamily member 13C, TNFRSF13C ELISA Kit
Sign In for Pricing
View Details MBS1484648-01 0.02 mg (Mammalian-Cell)
Recombinant Drosophila melanogaster Bursicon
Sign In for Pricing
View Details