PTOV1 Peptide - N-terminal region
PTOV1 Peptide - N-terminal region
Product Specifications
Product Name Alternative
PTOV1, ACID2, PP642, UNQ6127/PRO20092
UniProt
Q86YD1
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with PTOV1 Rabbit Polyclonal Antibody (orb581142) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
XP_005259057
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: LPCQAYVNQGENLETDQWPQKLIMQLIPQQLLTTLGPLFRNSQLAQFHFT
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
bs-1940R-BF647 100 µL
ZNF307/ZKSCAN3 Polyclonal Antibody, AbBy Fluor™ 647 Conjugated
Sign In for Pricing
View Details GTR15199735 1 Vial
Lentiviral mouse Mn1 shRNA (UAS) - Lentiviral mouse Mn1 shRNA (UAS) plasmid
Sign In for Pricing
View Details MBS9360283 Inquire
Donkey Ubiquitin/ISG15-Conjugating Enzyme E2 L6 (UBE2L6) ELISA Kit
Sign In for Pricing
View Details GTR10406913 96 Well
Rabbit Annexin V (ANX-V) antibody (IgG) ELISA Kit
Sign In for Pricing
View Details