Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF321P Peptide - C-terminal region

ZNF321P Peptide - C-terminal region

Product Specifications

Product Name Alternative

ZNF816-ZNF321

UniProt

Q8N8H1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ZNF321P Rabbit Polyclonal Antibody (orb325610) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LPELHIFQPEWKIGNQVEKSIINASLILTSQRISCSPKTRISNNYGNNSL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NAT8 Antibody
CSB-PA015474GA01HU 100 µL

NAT8 Antibody

Sign In for Pricing
View Details
EVL siRNA (Rat)
CRR2149-01 15 nmol

EVL siRNA (Rat)

Sign In for Pricing
View Details
EVL siRNA (Rat)
CRR2149-02 30 nmol

EVL siRNA (Rat)

Sign In for Pricing
View Details
7-Fluorophthalazin-1 (2H) -one
PC201210 1 Each

7-Fluorophthalazin-1 (2H) -one

Sign In for Pricing
View Details
Cinerin II
268589-01 1 mg

Cinerin II

Sign In for Pricing
View Details
Cinerin II
268589-02 2 mg

Cinerin II

Sign In for Pricing
View Details