Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF321P Peptide - C-terminal region

ZNF321P Peptide - C-terminal region

Product Specifications

Product Name Alternative

ZNF816-ZNF321

UniProt

Q8N8H1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ZNF321P Rabbit Polyclonal Antibody (orb325610) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LPELHIFQPEWKIGNQVEKSIINASLILTSQRISCSPKTRISNNYGNNSL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GKAP1 Rabbit Polyclonal Antibody (Biotin)
orb2086306 100 µL

GKAP1 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
Syntenin 1 Recombinant Antibody, PE-Cy7 Conjugated
bsm-61948R-PE-Cy7-TR 20 µL

Syntenin 1 Recombinant Antibody, PE-Cy7 Conjugated

Sign In for Pricing
View Details
CIITA Polyclonal Antibody
orb1420280 100 µL

CIITA Polyclonal Antibody

Sign In for Pricing
View Details
Compound PDK0214
orb3170315 200 mg

Compound PDK0214

Sign In for Pricing
View Details
8- Chloroadenosine- 3', 5'- cyclic monophosphate (8-Cl-cAMP), sodium salt
C 007-50 5x 10 µmol

8- Chloroadenosine- 3', 5'- cyclic monophosphate (8-Cl-cAMP), sodium salt

Sign In for Pricing
View Details
Mouse Monoclonal DMC1 Antibody (2H12/4) [HRP]
NB100-2617H 0.1 mL

Mouse Monoclonal DMC1 Antibody (2H12/4) [HRP]

Sign In for Pricing
View Details