Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF662 Peptide - N-terminal region

ZNF662 Peptide - N-terminal region

Product Specifications

UniProt

Q6ZS27

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ZNF662 Rabbit Polyclonal Antibody (orb325613) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_997287

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VPRGALDGEAPRGISSGYPFLKPAGISHPEQVEEPLNLKLQGEGPSLICP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue Total RNA, Cervix
CR561176 5 µg

Tissue Total RNA, Cervix

Sign In for Pricing
View Details
Monster Block ELISA Blocking Buffer
6296 500 mL

Monster Block ELISA Blocking Buffer

Sign In for Pricing
View Details
2-Isopropyl Thioxanthone
TRC-I873500-5G 5 g

2-Isopropyl Thioxanthone

Sign In for Pricing
View Details
IFluor® 680 goat anti-mouse IgG (H+L)
16745-AAT 1 mg

IFluor® 680 goat anti-mouse IgG (H+L)

Sign In for Pricing
View Details
ADPRM (NM_020233) Human Recombinant Protein
TP313957L 1 mg

ADPRM (NM_020233) Human Recombinant Protein

Sign In for Pricing
View Details
APC Rat IgG2b, λ Isotype Control[G013B8]
AN00565E-01 20 Tests

APC Rat IgG2b, λ Isotype Control[G013B8]

Sign In for Pricing
View Details