ZNF662 Peptide - N-terminal region
ZNF662 Peptide - N-terminal region
Product Specifications
UniProt
Q6ZS27
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with ZNF662 Rabbit Polyclonal Antibody (orb325613) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_997287
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: VPRGALDGEAPRGISSGYPFLKPAGISHPEQVEEPLNLKLQGEGPSLICP
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
GA109691 1 Kit
Human Sarcosine Oxidase (PIPOX) activation kit by CRISPRa
Sign In for Pricing
View Details 
BNUB2232-100 1x 100 µL
Carbonic Anhydrase VIII (CPTC-CA8-2), 0.2mg/mL
Sign In for Pricing
View Details 